Your browser doesn't support javascript.
loading
Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.
Cunha, Ricardo B; Santana, Alfredo N C; Amaral, Patrícia C; Carvalho, Maria D F; Carvalho, Doris M F; Cavalheiro, Esper A; Maigret, Bernard; Ricart, Carlos A O; Cardi, Bruno A; Sousa, Marcelo V; Carvalho, Krishnamurti M.
Afiliación
  • Cunha RB; Centro Brasileiro de Serviços e Pesquisas em Proteínas, Departamento de Biologia Celular, Universidade de Brasília, CEP 70.910-900 Brasília, DF, Brazil.
Toxicon ; 45(2): 207-17, 2005 Feb.
Article en En | MEDLINE | ID: mdl-15626370
The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone Bunodosoma cangicum, was determined: GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 residues that are conserved and the 5 that are conservatively substituted within or between the type 1 and type 2 sequences of sea anemone peptides with specific action on voltage-sensitive sodium channels. Furthermore, it also has 6 identities (Asp9, Arg14, Asn16, Leu18, Trp33 and Lys48) and 1 homology (Arg36) in the 8 residues of the pharmacophore of the sea anemone ApB which are essential for interaction with mammalian sodium channels. The intrahippocampal injection of CGX induces several sequential behavioral alterations--episodes of akinesia alternating with facial automatisms and head tremor, salivation, rearing, jumping, barrel-rolling, wet dog shakes and forelimb clonic movements--and the electroencephalography analysis shows that they were followed by important seizure periods that gradually evolved to status epilepticus that lasted 8-12 h, similar to that observed in the acute phase of the pilocarpine model of epilepsy. These results suggest that CGX may be an important tool to develop a new experimental model of status epilepticus which may contribute to understanding the etiology of epilepsy and to test the effects of new antiepileptic drugs.
Asunto(s)
Buscar en Google
Colección: 01-internacional Base de datos: MEDLINE Asunto principal: Convulsiones / Conducta Animal / Venenos de Cnidarios / Electroencefalografía Límite: Animals Idioma: En Revista: Toxicon Año: 2005 Tipo del documento: Article País de afiliación: Brasil Pais de publicación: Reino Unido
Buscar en Google
Colección: 01-internacional Base de datos: MEDLINE Asunto principal: Convulsiones / Conducta Animal / Venenos de Cnidarios / Electroencefalografía Límite: Animals Idioma: En Revista: Toxicon Año: 2005 Tipo del documento: Article País de afiliación: Brasil Pais de publicación: Reino Unido