RESUMO
PURPOSE: Advances in functional imaging allowed us to visualize brain glucose metabolism in vivo and non-invasively with [18F]fluoro-2-deoxyglucose (FDG) positron emission tomography (PET) imaging. In the past decades, FDG-PET has been instrumental in the understanding of brain function in health and disease. The source of the FDG-PET signal has been attributed to neuronal uptake, with hypometabolism being considered as a direct index of neuronal dysfunction or death. However, other brain cells are also metabolically active, including astrocytes. Based on the astrocyte-neuron lactate shuttle hypothesis, the activation of the glutamate transporter 1 (GLT-1) acts as a trigger for glucose uptake by astrocytes. With this in mind, we investigated glucose utilization changes after pharmacologically downregulating GLT-1 with clozapine (CLO), an anti-psychotic drug. METHODS: Adult male Wistar rats (control, n = 14; CLO, n = 12) received CLO (25/35 mg kg-1) for 6 weeks. CLO effects were evaluated in vivo with FDG-PET and cortical tissue was used to evaluate glutamate uptake and GLT-1 and GLAST levels. CLO treatment effects were also assessed in cortical astrocyte cultures (glucose and glutamate uptake, GLT-1 and GLAST levels) and in cortical neuronal cultures (glucose uptake). RESULTS: CLO markedly reduced in vivo brain glucose metabolism in several brain areas, especially in the cortex. Ex vivo analyses demonstrated decreased cortical glutamate transport along with GLT-1 mRNA and protein downregulation. In astrocyte cultures, CLO decreased GLT-1 density as well as glutamate and glucose uptake. By contrast, in cortical neuronal cultures, CLO did not affect glucose uptake. CONCLUSION: This work provides in vivo demonstration that GLT-1 downregulation induces astrocyte-dependent cortical FDG-PET hypometabolism-mimicking the hypometabolic signature seen in people developing dementia-and adds further evidence that astrocytes are key contributors of the FDG-PET signal.
Assuntos
Astrócitos , Clozapina , Animais , Clozapina/metabolismo , Clozapina/farmacologia , Fluordesoxiglucose F18/metabolismo , Glucose/metabolismo , Ácido Glutâmico/metabolismo , Ácido Glutâmico/farmacologia , Humanos , Masculino , Tomografia por Emissão de Pósitrons , Ratos , Ratos WistarRESUMO
Amyloid-ß (Aß) dysmetabolism is thought to be the main trigger for neurodegenerative events in Alzheimer's disease (AD). In particular, soluble Aß oligomers (AßOs) are proposed as key mediators of synaptic and cognitive dysfunction in AD. Over the past few decades, AßOs prepared from synthetic Aß have been widely applied in vitro and in vivo, the so-called chemical models of AD, uncovering their multiple neurotoxic mechanisms. However, the lack of a reliable quality control (QC) for synthetic AßOs may reflect poor experimental reproducibility. In keeping with this, we optimized and validated a rapid and reproducible SECHPLC method using fluorescence detection for the QC of synthetic AßOs. Our analytical method offers an unprecedent alternative to improve the reproducibility of AD chemical models.
Assuntos
Peptídeos beta-Amiloides/análise , Cromatografia em Gel/métodos , Multimerização Proteica , Doença de Alzheimer/patologia , Animais , Cromatografia Líquida de Alta Pressão , Humanos , Concentração de Íons de Hidrogênio , Controle de Qualidade , Reprodutibilidade dos Testes , TemperaturaRESUMO
BACKGROUND: Cancer is a multifactorial disease, representing one of the leading causes of death worldwide. On a global estimate, breast cancer is the most frequently occurring cancer in women and cervical cancer, the fourth most common. Both types of cancer remain the major cause of cancer-related mortality in developing countries. A strategy for rational drug design is hybridization, which aims to bring together in one molecule, two or more pharmacophores in order to reach several biological targets. OBJECTIVE: The objective of this work was to develop new hybrids based on natural pharmacophores: Betulinic acid (1) and brosimine b (2), active in female cancer cell lines. METHODS: The coupling reactions were carried out by Steglich esterification. Different compounds were designed for the complete and simplified structural hybridization of molecules. The anticancer activities of the compounds were evaluated in human cervical adenocarcinoma (HeLa), human cervical metastatic epidermoid carcinoma (ME-180), and human breast adenocarcinoma (MCF-7) cell lines. RESULTS: Hybrid 3 presented higher potency (IC50 = 9.2 ± 0.5µM) and SI (43.5) selectively in MCF-7 cells (in relation to Vero cells) with its cytotoxic effect occurring via apoptosis. In addition, compound 6 showed activity in MCF-7 and HeLa cells with intermediate potency, but with high efficacy, acting via apoptosis as well. CONCLUSION: In this context, we showed that the combination of two complex structures generated the development of hybrids with differing inhibitory profiles and apoptotic modes of action, thus representing potential alternatives in female cancer treatment.
Assuntos
Antineoplásicos Fitogênicos/farmacologia , Flavonoides/farmacologia , Triterpenos Pentacíclicos/farmacologia , Antineoplásicos Fitogênicos/síntese química , Antineoplásicos Fitogênicos/química , Apoptose/efeitos dos fármacos , Proliferação de Células/efeitos dos fármacos , Sobrevivência Celular/efeitos dos fármacos , Relação Dose-Resposta a Droga , Ensaios de Seleção de Medicamentos Antitumorais , Feminino , Flavonoides/síntese química , Flavonoides/química , Células HeLa , Humanos , Conformação Molecular , Moraceae/química , Triterpenos Pentacíclicos/síntese química , Triterpenos Pentacíclicos/química , Plantas Medicinais/química , Relação Estrutura-Atividade , Células Tumorais Cultivadas , Ácido BetulínicoRESUMO
The plant Cocos nucifera and its derivatives have shown antidepressant-like effects, although its hydroalcoholic extract has not been studied with this end in mind. Therefore, we decided to determine the antidepressant-like effects of the standardized hydroalcoholic extract of Cocos nucifera husk fiber (HECN) as well as oxidative alterations in the prefrontal cortex (PFC), hippocampus (HC) and striatum (ST), and the levels of brain-derived neurotrophic factor (BDNF) in the HC of mice. The extract was characterized based on the content of total polyphenols as well as two phenol compounds-catechin and chlorogenic acid-by HPLC-PDA. Male animals were treated per os (p.o.) for 7 days with distilled water or HECN (50, 100 or 200 mg/kg), or intraperitoneally with vitamin E (Vit E 400 mg/kg). One hour after the last drug administration, the animals were submitted to the open field test, forced swimming test (FST), tail suspension test (TST) and, immediately after the behavioral tests, had their brain removed for neurochemical determinations. The results showed that HECN100 decreased the immobility time in the FST and TST presenting, thus demonstrating an antidepressant-like effect. The administration of HECN decreased malondialdehyde levels in all doses and brain areas studied with the exception of HECN50 in the HC. The administration of HECN also decreased nitrite levels in all doses and brain regions studied. HECN100 also increased the levels of BDNF in HC of mice. In conclusion, we demonstrated that HECN has antidepressant-like properties, probably based on its antioxidant and neurotrophic effects, and is thus relevant for the treatment of depression.
Assuntos
Antidepressivos/química , Antioxidantes/química , Cocos/química , Extratos Vegetais/farmacologia , Animais , Antidepressivos/isolamento & purificação , Antidepressivos/farmacologia , Antioxidantes/isolamento & purificação , Antioxidantes/farmacologia , Comportamento Animal/efeitos dos fármacos , Fator Neurotrófico Derivado do Encéfalo/metabolismo , Corpo Estriado/efeitos dos fármacos , Corpo Estriado/metabolismo , Modelos Animais de Doenças , Hipocampo/efeitos dos fármacos , Hipocampo/metabolismo , Masculino , Camundongos , Estresse Oxidativo/efeitos dos fármacos , Extratos Vegetais/química , Extratos Vegetais/isolamento & purificação , Córtex Pré-Frontal/efeitos dos fármacos , Córtex Pré-Frontal/metabolismoRESUMO
In this study a novel heat-stable lipid transfer protein, designated McLTP1, was purified from noni (Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg McLTP1 from 100g of noni seeds). McLTP1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of McLTP1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. McLTP1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 °C. Pretreatment of mice with McLTP1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of McLTP1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein.
Assuntos
Analgésicos/isolamento & purificação , Analgésicos/farmacologia , Antígenos de Plantas/isolamento & purificação , Antígenos de Plantas/farmacologia , Proteínas de Transporte/isolamento & purificação , Proteínas de Transporte/farmacologia , Morinda/química , Proteínas de Plantas/isolamento & purificação , Proteínas de Plantas/farmacologia , Sementes/química , Sequência de Aminoácidos , Analgésicos/química , Animais , Antígenos de Plantas/química , Proteínas de Transporte/química , Relação Dose-Resposta a Droga , Estabilidade de Medicamentos , Masculino , Camundongos , Proteínas de Plantas/química , Reflexo/efeitos dos fármacosRESUMO
INTRODUCTION: Acute kidney injury (AKI) remains a great problem in clinical practice. Renal ischemia/reperfusion (I/R) injury is a complex pathophysiological process. Propolis is a natural polyphenol-rich resinous substance collected by honeybees from a variety of plant sources that has anti-inflammatory and anti-oxidative properties. Red propolis (RP) protection in renal I/R injury was investigated. METHODS: Male Wistar rats underwent unilateral nephrectomy and contralateral renal I/R (60 min). Rats were divided into four groups: (1) sham group, (2) RP group (sham-operated rats treated with RP), 3) IR group (rats submitted to ischemia) and (4) IR-RP (rats treated with RP before ischemia). At 48 h after reperfusion, renal function was assessed and kidneys were removed for analysis. RESULTS: I/R increased plasma levels of creatinine and reduced creatinine clearance (CrCl), and RP provided protection against this renal injury. Red propolis significantly improves oxidative stress parameters when compared with the IR group. Semiquantitative assessment of the histological lesions showed marked structural damage in I/R rats compared with the IR-RP rats. RP attenuates I/R-induced endothelial nitric oxide-synthase down regulation and increased heme-oxygenase expression in renal tissue. CONCLUSION: Red propolis protects kidney against acute ischemic renal failure and this protection is associated with reduced oxidative stress and eNOS and heme-oxygenase up regulation.
Assuntos
Injúria Renal Aguda/tratamento farmacológico , Própole/uso terapêutico , Traumatismo por Reperfusão/tratamento farmacológico , Animais , Abelhas , Creatinina/química , Heme Oxigenase (Desciclizante)/metabolismo , Rim/fisiopatologia , Peroxidação de Lipídeos , Masculino , Malondialdeído/química , Óxido Nítrico Sintase Tipo III/metabolismo , Estresse Oxidativo , Ratos WistarRESUMO
Dermatomycosis causes highly frequent dermal lesions, and volatile oils have been proven to be promising as antifungal agents. The antifungal activity of geraniol, nerol, citral, neral and geranial (monoterpenes), and terbinafine and anidulafungin (control drugs) against seven opportunistic pathogenic yeasts and four dermatophyte species was evaluated by the Clinical and Laboratory Standards Institute microdilution tests. Monoterpenes were more active against dermatophytes than yeasts (geometric mean of minimal inhibitory concentration (GMIC) of 34.5 and 100.4 µg.ml-1, respectively). Trichophyton rubrum was the fungal species most sensitive to monoterpenes (GMIC of 22.9 µg.ml-1). The trans isomers showed higher antifungal activity than the cis. The mechanism of action was investigated evaluating damage in the fungal cell wall (Sorbitol Protection Assay) and in the cell membrane (Ergosterol Affinity Assay). No changes were observed in the MIC of monoterpenes in the sorbitol protection assay.The MIC of citral and geraniol was increased from 32 to 160 µg.ml-1 when the exogenous ergosterol concentrations was zero and 250 µg.ml-1, respectively. The monoterpenes showed an affinity for ergosterol relating their mechanism of action to cell membrane destabilization.
RESUMO
This study describes and characterizes methods for high-performance liquid chromatography diode array detection (HPLC-DAD) analysis of formulations containing molecules with antifungal activity of three different classes: terbinafine and butenafine (allylamines), miconazole and fluconazole (azoles), and geraniol, neral and geranial (monoterpenes). All methods used the same chromatographic column (RP18 ), enabling the analysis to be performed in a single batch. The specificity was extensively discussed through the establishment of purity peak methods. The analytical parameters (linearity, precision and accuracy) were calculated and discussed in detail using specific statistical approaches. All substances showed satisfactory results for chromatographic and analytical parameters. Limits of 1.3% to mean repeatability and 2.0% for intermediate precision are suggested as acceptance criteria in validation of methods by HPLC-DAD, in situations where there is no extensive pretreatment of the samples. The methods proved to be robust and significant factors were discussed regarding their influence on chromatographic parameters (retention time, resolution, tailing factor and column efficiency). Finally, the application of the developed methods was demonstrated by the results of a permeation study of the antifungal agents through bovine hoof membranes.
Assuntos
Antifúngicos/análise , Cromatografia Líquida de Alta Pressão/métodos , Animais , Antifúngicos/química , Antifúngicos/farmacocinética , Bovinos , Casco e Garras/metabolismo , Concentração de Íons de Hidrogênio , Modelos Lineares , Permeabilidade , Reprodutibilidade dos Testes , Sensibilidade e EspecificidadeRESUMO
Invasive aspergillosis (IA) seems to be an emerging condition in intensive care units (ICUs). However, little attention has been given to the role of environmental factors that could increase the risk for IA in the ICU. The objective of this study was to determine the concentration of airborne fungi in three Brazilian ICUs, in an attempt to correlate fungal burden with the frequency of Aspergillus spp isolation from clinical samples of patients hospitalised in these units. During a 1-year period we quantitatively evaluated the presence of fungi in the air of three ICUs in Porto Alegre, Brazil. The quantity of fungi was correlated with environmental factors. Only one of the ICUs studied showed equal concentrations of Aspergillus conidia in the indoor air, in comparison with the outdoor environment. All cases of Aspergillus colonisation and IA cases observed during the study occurred in that particular ICU. Environmental factors have a direct influence on fungal spore concentration in the air in ICUs, as well as air filtration systems in air conditioners. Fungal contamination of the indoor air may influence the frequency of AI in ICU patients.
Assuntos
Microbiologia do Ar , Poluição do Ar em Ambientes Fechados , Aspergillus/isolamento & purificação , Aspergilose Pulmonar Invasiva/epidemiologia , Brasil , Contagem de Colônia Microbiana , Humanos , Unidades de Terapia Intensiva , PrevalênciaRESUMO
Este estudo teve como objetivo avaliar a estabilidade de xaropes contendo carbocisteína, submetidos à degradação forçada, utilizando Desenho Experimental Fatorial (DEF). Os fatores avaliados foram pH (5,0; 6,5; 8,0), presença ou ausência de EDTA dissódico e metabissulfito de sódio (0,1%). Para o estudo de degradação forçada, as formulações foram submetidas a estresse térmico (50 °C e 75% UR) e oxidação com peróxido de hidrogênio a 3%. Posteriormente, as formulações foram analisadas quanto ao pH, propriedades organolépticas e teor de fármaco por CLAE-UV, nos tempos 0, 15 e 35 dias. Os resultados mostraram que as formulações submetidas à degradação forçada sofreram uma diminuição no teor do fármaco, enquanto que o pH se manteve relativamente estável. Em relação a cor, apenas as formulações que não possuíam antioxidantes mostraram-se mais escuras. A análise dos resultados do DEF mostrou interação significativa (p<0,05) para os fatores pH/metabissulfito e EDTA/metabissulfito. As formulações contendo metabissulfito em pH 5,0 apresentaram maior degradação e as formulações com metabissulfito sem EDTA também não foram eficientes para impedir a degradação da carbocisteína.
The aim of this study was to use Factorial Design (FD) to assess the stability of carbocisteine syrups subjected to forced degradation. The factors assessed were pH (5.0; 6.5; 8.0), presence or absence of disodium EDTA and sodium metabisulfite (0.1%). For the study of forced degradation, the formulations were subjected to thermal stress (50°C and 75% RH) and oxidation with 3% hydrogen peroxide. The formulations were analyzed for pH, organoleptic properties and drug content by HPLC-UV, at 0, 15 and 35 days. The results showed that the formulations exposed to forced degradation suffered a fall in drug content, while the pH remained relatively stable. Regarding the color, only the formulations without antioxidant exhibited a darker coloration. The results of FD revealed significant interactions (p<0.05) for pH/metabisulfite and EDTA / metabisulfite. Formulations containing metabisulfite at pH 5.0 showed the greatest degradation and those with metabisulfite and without EDTA were also not effective in preventing the degradation of carbocisteine.
Assuntos
Carbocisteína/análise , Estabilidade de Medicamentos , Expectorantes , Análise FatorialRESUMO
Environmental air monitoring is a common practice in many institutions. However, the methodology involved in different studies has not been standardized, with most centers incubating samples at room temperature. Here we demonstrate that the incubation of plates at 35-40°C facilitates growth of Aspergillus section Fumigati, the most important pathogenic mold in humans. We examine the implications of these findings.
Assuntos
Microbiologia do Ar , Aspergillus/isolamento & purificação , Aspergillus/efeitos da radiação , Técnicas Microbiológicas/métodos , Aspergillus/crescimento & desenvolvimento , Hospitais , Humanos , TemperaturaRESUMO
ETHNOPHARMACOLOGICAL RELEVANCE: Peppers from Capsicum species (Solanaceae) are native to Central and South America, and are commonly used as food and also for a broad variety of medicinal applications. AIM OF THE STUDY: The red pepper Capsicum baccatum var. pendulum is widely consumed in Brazil, but there are few reports in the literature of studies on its chemical composition and biological properties. In this study the antioxidant and anti-inflammatory activities of Capsicum baccatum were evaluated and the total phenolic compounds and flavonoid contents were determined. MATERIALS AND METHODS: The antioxidant property was assayed by scavenging abilities using DPPH and the anti-inflammatory activity was tested through the carrageenan-induced pleurisy model in mice. The total phenolic compounds and flavonoid contents were determined spectrophotometrically. RESULTS: The ethanolic and butanol extracts (200mg/kg, p.o.) presented a significant anti-inflammatory activity toward carrageenan-induced pleurisy model in mice in comparison to dexamethasone (0.5mg/kg, s.c.). Among the parameters evaluated, the treatment with these samples inhibited leukocyte migration and reduced the formation of exudate. The contents of flavonoids and total phenolic compounds could be correlated with the antioxidant and anti-inflammatory activities observed for Capsicum baccatum. CONCLUSIONS: Our findings suggest that Capsicum baccatum contains potential antioxidant and anti-inflammatory compounds which could be tested as drug candidates against oxidative and inflammation-related pathological processes in medicinal chemistry studies.