Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 4 de 4
Filtrar
Mais filtros











Base de dados
Intervalo de ano de publicação
1.
J Hazard Mater ; 264: 153-60, 2014 Jan 15.
Artigo em Inglês | MEDLINE | ID: mdl-24295766

RESUMO

Maghemite nanoparticles (MNPs) were functionalized with glycine, by a cost-effective and environmentally friendly procedure, as an alternative route to typical amine-functionalized polymeric coatings, for highly efficient removal of copper ions from water. MNPs were synthesized by co-precipitation method and adsorption of glycine was investigated as a function of ligand concentration and pH. The efficiency of these functionalized nanoparticles for removal of Cu(2+) from water has been explored and showed that adsorption is highly dependent of pH and that it occurs either by forming chelate complexes and/or by electrostatic interaction. The adsorption process, which reaches equilibrium in few minutes and fits a pseudo second-order model, follows the Langmuir adsorption model with a very high maximum adsorption capacity for Cu(2+) of 625mg/g. Furthermore, these nanoadsorbents can be used as highly efficient separable and reusable materials for removal of toxic metal ions.


Assuntos
Cobre/isolamento & purificação , Compostos Férricos/química , Glicina/química , Nanopartículas Metálicas/química , Poluentes Químicos da Água/isolamento & purificação , Águas Residuárias/química
2.
J Proteome Res ; 11(3): 1485-93, 2012 Mar 02.
Artigo em Inglês | MEDLINE | ID: mdl-22181811

RESUMO

A large-scale mapping of the worker honeybee brain proteome was achieved by MudPIT. We identified 2742 proteins from forager and nurse honeybee brain samples; 17% of the total proteins were found to be differentially expressed by spectral count sampling statistics and a G-test. Sequences were compared with the EuKaryotic Orthologous Groups (KOG) catalog set using BLASTX and then categorized into the major KOG categories of most similar sequences. According to this categorization, nurse brain showed increased expression of proteins implicated in translation, ribosomal structure, and biogenesis (14.5%) compared with forager (1.8%). Experienced foragers overexpressed proteins involved in energy production and conversion, showing an extensive difference in this set of proteins (17%) in relation to the nurse subcaste (0.6%). Examples of proteins selectively expressed in each subcaste were analyzed. A comparison between these MudPIT experiments and previous 2-DE experiments revealed nine coincident proteins differentially expressed in both methodologies.


Assuntos
Abelhas/metabolismo , Encéfalo/metabolismo , Proteínas de Insetos/metabolismo , Proteoma/metabolismo , Animais , Cromatografia Líquida de Alta Pressão , Eletroforese em Gel Bidimensional , Expressão Gênica , Perfilação da Expressão Gênica , Proteínas de Insetos/genética , Proteínas de Insetos/isolamento & purificação , Isoformas de Proteínas/química , Isoformas de Proteínas/isolamento & purificação , Isoformas de Proteínas/metabolismo , Proteoma/genética , Proteoma/isolamento & purificação
3.
Toxicon ; 45(2): 207-17, 2005 Feb.
Artigo em Inglês | MEDLINE | ID: mdl-15626370

RESUMO

The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone Bunodosoma cangicum, was determined: GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 residues that are conserved and the 5 that are conservatively substituted within or between the type 1 and type 2 sequences of sea anemone peptides with specific action on voltage-sensitive sodium channels. Furthermore, it also has 6 identities (Asp9, Arg14, Asn16, Leu18, Trp33 and Lys48) and 1 homology (Arg36) in the 8 residues of the pharmacophore of the sea anemone ApB which are essential for interaction with mammalian sodium channels. The intrahippocampal injection of CGX induces several sequential behavioral alterations--episodes of akinesia alternating with facial automatisms and head tremor, salivation, rearing, jumping, barrel-rolling, wet dog shakes and forelimb clonic movements--and the electroencephalography analysis shows that they were followed by important seizure periods that gradually evolved to status epilepticus that lasted 8-12 h, similar to that observed in the acute phase of the pilocarpine model of epilepsy. These results suggest that CGX may be an important tool to develop a new experimental model of status epilepticus which may contribute to understanding the etiology of epilepsy and to test the effects of new antiepileptic drugs.


Assuntos
Comportamento Animal/efeitos dos fármacos , Venenos de Cnidários/química , Venenos de Cnidários/toxicidade , Eletroencefalografia/efeitos dos fármacos , Convulsões/induzido quimicamente , Sequência de Aminoácidos , Animais , Masculino , Dados de Sequência Molecular , Ratos , Ratos Wistar , Anêmonas-do-Mar , Homologia de Sequência de Aminoácidos
4.
FEBS Lett ; 549(1-3): 47-51, 2003 Aug 14.
Artigo em Inglês | MEDLINE | ID: mdl-12914923

RESUMO

Enterolobin is a plant cytolytic protein similar to the bacterial cytolysin aerolysin. Biochemical and biophysical techniques were used to verify if enterolobin, like aerolysin, adopts a dimeric structure in solution. SDS-PAGE showed bands corresponding to enterolobin monomer, dimer and oligomers, whilst gel filtration chromatography and electrospray mass spectrometry revealed preferred association of enterolobin as a dimer. Atomic force microscopy (AFM) of enterolobin showed images of a dimer assembly at a concentration as low as 10 microg/ml, similarly to aerolysin. The enterolobin in silico docked structure is coherent with AFM enterolobin dimer shapes.


Assuntos
Citotoxinas/química , Cromatografia em Gel , Dimerização , Eletroforese em Gel de Poliacrilamida , Microscopia de Força Atômica , Modelos Moleculares , Estrutura Quaternária de Proteína , Soluções , Espectrometria de Massas por Ionização por Electrospray
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA